SCOPe 2.08: Domain d1lrva_: 1lrv A:

Lineage for d1lrva_ (1lrv A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.5: Leucine-rich repeat variant [48396] (1 protein)
   this is a repeat family; one repeat unit is 1lrv A:123-147 found in domain

6. Protein Leucine-rich repeat variant [48397] (1 species)
   contains a FeS4 centre

7. Species Azotobacter vinelandii [TaxId:354] [48398] (1 PDB entry)

8. Domain d1lrva_: 1lrv A: [19146]

Details for d1lrva_

PDB Entry: 1lrv, 2.6 Å

PDB Description: a leucine-rich repeat variant with a novel repetitive protein structural motif

PDB Compounds: (A:) leucine-rich repeat variant

SCOPe Domain Sequences for d1lrva_:

Sequence; same for both SEQRES and ATOM records:

>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]}
tpigdcrvcsfrmsllltgrctpgdacvavesgrqidrffrnnphlavqyladpfwerra
iavryspvealtplirdsdevvrravayrlpreqlsalmfdedrevritvadrlpleqle
qmaadrdylvrayvvqrippgrlfrfmrdedrqvrklvakrlpeeslglmtqdpepevrr
ivasrlrgddllellhdpdwtvrlaavehaslealreldepdpevrlaiagrl

Timeline for d1lrva_:

• d1lrva_ first appeared (with stable ids) in SCOP 1.55, called d1lrv__
  
• d1lrva_ appears in SCOPe 2.07