![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
![]() | Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) ![]() |
![]() | Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) |
![]() | Protein automated matches [190303] (2 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:318586] [189284] (15 PDB entries) |
![]() | Domain d3pxse_: 3pxs E: [184066] automated match to d1mg2b_ complexed with act, ca, hec, na, pg4, pg6 |
PDB Entry: 3pxs (more details), 2.22 Å
SCOPe Domain Sequences for d3pxse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pxse_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d3pxse_: