Lineage for d3pxse_ (3pxs E:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462380Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1462381Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1462382Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1462403Protein automated matches [190303] (2 species)
    not a true protein
  7. 1462434Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)
  8. 1462470Domain d3pxse_: 3pxs E: [184066]
    Other proteins in same PDB: d3pxsd_, d3pxsf_
    automated match to d1mg2b_
    complexed with act, ca, hec, na, pg4, pg6

Details for d3pxse_

PDB Entry: 3pxs (more details), 2.22 Å

PDB Description: crystal structure of diferrous maug in complex with pre-methylamine dehydrogenase:
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3pxse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxse_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3pxse_:

Click to download the PDB-style file with coordinates for d3pxse_.
(The format of our PDB-style files is described here.)

Timeline for d3pxse_: