Lineage for d1mg2b_ (1mg2 B:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243277Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1243278Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1243279Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
  6. 1243280Protein Methylamine dehydrogenase [57563] (2 species)
  7. 1243281Species Paracoccus denitrificans [TaxId:266] [57564] (6 PDB entries)
  8. 1243284Domain d1mg2b_: 1mg2 B: [79060]
    Other proteins in same PDB: d1mg2a_, d1mg2c_, d1mg2d_, d1mg2e_, d1mg2g_, d1mg2h_, d1mg2i_, d1mg2k_, d1mg2l_, d1mg2m_, d1mg2o_, d1mg2p_
    complexed with cu, hem, na, po4; mutant

Details for d1mg2b_

PDB Entry: 1mg2 (more details), 2.25 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (B:) Methylamine dehydrogenase, light chain

SCOPe Domain Sequences for d1mg2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg2b_ g.21.1.1 (B:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d1mg2b_:

Click to download the PDB-style file with coordinates for d1mg2b_.
(The format of our PDB-style files is described here.)

Timeline for d1mg2b_: