PDB entry 3pxs

View 3pxs on RCSB PDB site
Description: Crystal Structure of Diferrous MauG in Complex with Pre-Methylamine Dehydrogenase:
Class: oxidoreductase/electron transport
Keywords: Oxidoreductase, electron transport, periplasmic space, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2010-12-10, released 2011-03-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.18
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
• Chain 'B':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
• Chain 'C':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22619 (Start-130)
  Domains in SCOPe 2.02: d3pxsc_
• Chain 'D':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauB
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-385)
• Chain 'E':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22619 (Start-130)
  Domains in SCOPe 2.02: d3pxse_
• Chain 'F':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauB
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-385)
• Heterogens: NA, HEC, CA, ACT, PG4, PG6, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3pxsC (C:)
  adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
  cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
  ctispivgkashhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3pxsC (C:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >3pxsE (E:)
  adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
  cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
  ctispivgkashhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3pxsE (E:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'F':
  No sequence available.