Lineage for d3pxsc_ (3pxs C:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243277Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1243278Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1243279Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
  6. 1243300Protein automated matches [190303] (2 species)
    not a true protein
  7. 1243331Species Paracoccus denitrificans [TaxId:318586] [189284] (15 PDB entries)
  8. 1243357Domain d3pxsc_: 3pxs C: [184065]
    automated match to d1mg2b_
    complexed with act, ca, hec, na, pg4, pg6

Details for d3pxsc_

PDB Entry: 3pxs (more details), 2.22 Å

PDB Description: crystal structure of diferrous maug in complex with pre-methylamine dehydrogenase:
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3pxsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxsc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3pxsc_:

Click to download the PDB-style file with coordinates for d3pxsc_.
(The format of our PDB-style files is described here.)

Timeline for d3pxsc_: