| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein D-maltodextrin-binding protein, MBP [53862] (5 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
| Species Escherichia coli [TaxId:562] [53863] (69 PDB entries) Uniprot P02928 |
| Domain d3puze_: 3puz E: [183986] Other proteins in same PDB: d3puza1, d3puza2, d3puzb1, d3puzb2, d3puzf1, d3puzf2, d3puzg_ automated match to d1anfa_ complexed with anp, mg, pgv has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3puz (more details), 2.9 Å
SCOPe Domain Sequences for d3puze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3puze_ c.94.1.1 (E:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfgcyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmcafwyavrtavinaasgrqtvdea
lkdaqtritk
Timeline for d3puze_: