SCOPe 2.08: Domain d3puza2: 3puz A:236-371

Lineage for d3puza2 (3puz A:236-371)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)

8. Domain d3puza2: 3puz A:236-371 [200250]
   Other proteins in same PDB: d3puza1, d3puzb1, d3puze_, d3puzf1, d3puzf2, d3puzg_
   automated match to d1q12a1
   complexed with anp, mg, pgv

Details for d3puza2

PDB Entry: 3puz, 2.9 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp

PDB Compounds: (A:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3puza2:

Sequence; same for both SEQRES and ATOM records:

>d3puza2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

Timeline for d3puza2:

• d3puza2 first appeared in SCOPe 2.03
  
• d3puza2 appears in SCOPe 2.07