Lineage for d3puza2 (3puz A:236-371)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790988Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2791072Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2791092Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2791093Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2791116Domain d3puza2: 3puz A:236-371 [200250]
    Other proteins in same PDB: d3puza1, d3puzb1, d3puze_, d3puzf1, d3puzf2, d3puzg_
    automated match to d1q12a1
    complexed with anp, mg, pgv

Details for d3puza2

PDB Entry: 3puz (more details), 2.9 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
PDB Compounds: (A:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3puza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puza2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

SCOPe Domain Coordinates for d3puza2:

Click to download the PDB-style file with coordinates for d3puza2.
(The format of our PDB-style files is described here.)

Timeline for d3puza2: