Lineage for d1q12a1 (1q12 A:236-370)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790988Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2791072Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2791092Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2791093Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2791108Domain d1q12a1: 1q12 A:236-370 [95529]
    Other proteins in same PDB: d1q12a2, d1q12b2, d1q12c2, d1q12d2
    complexed with atp

Details for d1q12a1

PDB Entry: 1q12 (more details), 2.6 Å

PDB Description: Crystal Structure of the ATP-bound E. coli MalK
PDB Compounds: (A:) Maltose/maltodextrin transport ATP-binding protein malK

SCOPe Domain Sequences for d1q12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q12a1 b.40.6.3 (A:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOPe Domain Coordinates for d1q12a1:

Click to download the PDB-style file with coordinates for d1q12a1.
(The format of our PDB-style files is described here.)

Timeline for d1q12a1: