SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q12c1 (1q12 C:236-370)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2052558Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2052642Family b.40.6.3: ABC-transporter additional domain [50338] (4 protein domains)
    probably stems out from the biMOP domain
  6. 2052662Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2052663Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2052680Domain d1q12c1: 1q12 C:236-370 [95533]
    Other proteins in same PDB: d1q12a2, d1q12b2, d1q12c2, d1q12d2
    complexed with atp

Details for d1q12c1

PDB Entry: 1q12 (more details), 2.6 Å

PDB Description: Crystal Structure of the ATP-bound E. coli MalK
PDB Compounds: (C:) Maltose/maltodextrin transport ATP-binding protein malK

SCOPe Domain Sequences for d1q12c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q12c1 b.40.6.3 (C:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOPe Domain Coordinates for d1q12c1:

Click to download the PDB-style file with coordinates for d1q12c1.
(The format of our PDB-style files is described here.)

Timeline for d1q12c1: