Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species) |
Species Escherichia coli [TaxId:562] [101772] (15 PDB entries) |
Domain d3puzb2: 3puz B:236-371 [200252] Other proteins in same PDB: d3puza1, d3puzb1, d3puze_, d3puzf1, d3puzf2, d3puzg_ automated match to d1q12a1 complexed with anp, mg, pgv |
PDB Entry: 3puz (more details), 2.9 Å
SCOPe Domain Sequences for d3puzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3puzb2 b.40.6.3 (B:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]} spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf redgtacrrlhkepgv
Timeline for d3puzb2: