Lineage for d3puze_ (3puz E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1008648Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 1008657Species Escherichia coli [TaxId:562] [53863] (47 PDB entries)
    Uniprot P02928
  8. 1008697Domain d3puze_: 3puz E: [183986]
    Other proteins in same PDB: d3puzg_
    automated match to d1anfa_
    complexed with anp, mal, mg, pgv

Details for d3puze_

PDB Entry: 3puz (more details), 2.9 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
PDB Compounds: (E:) Maltose transporter subunit; periplasmic-binding component of ABC superfamily

SCOPe Domain Sequences for d3puze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puze_ c.94.1.1 (E:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfgcyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmcafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOPe Domain Coordinates for d3puze_:

Click to download the PDB-style file with coordinates for d3puze_.
(The format of our PDB-style files is described here.)

Timeline for d3puze_: