SCOPe 2.08: Domain d1cowb1: 1cow B:380-510

Lineage for d1cowb1 (1cow B:380-510)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
   Uniprot P19483

8. Domain d1cowb1: 1cow B:380-510 [18306]
   Other proteins in same PDB: d1cowa2, d1cowa3, d1cowb2, d1cowb3, d1cowc2, d1cowc3, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3, d1cowg_
   complexed with adp, anp, aur, mg

Details for d1cowb1

PDB Entry: 1cow, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowb1:

Sequence; same for both SEQRES and ATOM records:

>d1cowb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Timeline for d1cowb1:

• d1cowb1 first appeared (with stable ids) in SCOP 1.55
  
• d1cowb1 appears in SCOPe 2.07