| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
| Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries) Uniprot P19483 |
| Domain d1cowa1: 1cow A:380-510 [18305] Other proteins in same PDB: d1cowa2, d1cowa3, d1cowb2, d1cowb3, d1cowc2, d1cowc3, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3, d1cowg_ complexed with adp, anp, aur, mg |
PDB Entry: 1cow (more details), 3.1 Å
SCOPe Domain Sequences for d1cowa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cowa1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea
Timeline for d1cowa1: