Lineage for d1cowb2 (1cow B:24-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798609Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2798610Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2798629Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 2798673Domain d1cowb2: 1cow B:24-94 [26471]
    Other proteins in same PDB: d1cowa1, d1cowa3, d1cowb1, d1cowb3, d1cowc1, d1cowc3, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3, d1cowg_
    complexed with adp, anp, aur, mg

Details for d1cowb2

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b
PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowb2 b.49.1.1 (B:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d1cowb2:

Click to download the PDB-style file with coordinates for d1cowb2.
(The format of our PDB-style files is described here.)

Timeline for d1cowb2: