SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1cowc3 (1cow C:95-379)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112187Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species)
  7. 2112206Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries)
    Uniprot P19483
  8. 2112251Domain d1cowc3: 1cow C:95-379 [32352]
    Other proteins in same PDB: d1cowa1, d1cowa2, d1cowb1, d1cowb2, d1cowc1, d1cowc2, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3, d1cowg_
    complexed with adp, anp, aur, mg

Details for d1cowc3

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b
PDB Compounds: (C:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowc3 c.37.1.11 (C:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d1cowc3:

Click to download the PDB-style file with coordinates for d1cowc3.
(The format of our PDB-style files is described here.)

Timeline for d1cowc3: