SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1cowe2 (1cow E:9-81)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058388Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2058389Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2058390Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 protein domains)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2058461Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2058510Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
    Uniprot P00829
  8. 2058572Domain d1cowe2: 1cow E:9-81 [26474]
    Other proteins in same PDB: d1cowa1, d1cowa2, d1cowa3, d1cowb1, d1cowb2, d1cowb3, d1cowc1, d1cowc2, d1cowc3, d1cowd1, d1cowd3, d1cowe1, d1cowe3, d1cowf1, d1cowf3, d1cowg_
    complexed with adp, anp, aur, mg

Details for d1cowe2

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b
PDB Compounds: (E:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowe2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d1cowe2:

Click to download the PDB-style file with coordinates for d1cowe2.
(The format of our PDB-style files is described here.)

Timeline for d1cowe2: