Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries) Uniprot P00829 |
Domain d1cowd2: 1cow D:9-81 [26473] Other proteins in same PDB: d1cowa1, d1cowa2, d1cowa3, d1cowb1, d1cowb2, d1cowb3, d1cowc1, d1cowc2, d1cowc3, d1cowd1, d1cowd3, d1cowe1, d1cowe3, d1cowf1, d1cowf3, d1cowg_ complexed with adp, anp, aur, mg |
PDB Entry: 1cow (more details), 3.1 Å
SCOPe Domain Sequences for d1cowd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cowd2 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d1cowd2: