![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class alpha GST [81349] (8 species) |
![]() | Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [47628] (2 PDB entries) |
![]() | Domain d1b48b1: 1b48 B:80-222 [17704] Other proteins in same PDB: d1b48a2, d1b48b2 complexed with gsh, hag |
PDB Entry: 1b48 (more details), 2.6 Å
SCOPe Domain Sequences for d1b48b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b48b1 a.45.1.1 (B:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} nlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydlilsraktryfpvfeki lkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisniptikkflq pgsqrkpppdgpyvevvrivlkf
Timeline for d1b48b1: