PDB entry 1b48

View 1b48 on RCSB PDB site
Description: crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4
Class: transferase
Keywords: crystal structure, glutathione s-transferase, gst, subunit cooperativity
Deposited on 1999-01-06, released 1999-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutathione s-transferase)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b48a1, d1b48a2
  • Chain 'B':
    Compound: protein (glutathione s-transferase)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b48b1, d1b48b2
  • Heterogens: HAG, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b48A (A:)
    aakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveid
    gmmltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekeesy
    dlilsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpll
    qafktrisniptikkflqpgsqrkpppdgpyvevvrivlkf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b48B (B:)
    aakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveid
    gmmltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekeesy
    dlilsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpll
    qafktrisniptikkflqpgsqrkpppdgpyvevvrivlkf