Lineage for d1b48a1 (1b48 A:80-222)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712973Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [47628] (2 PDB entries)
  8. 2712974Domain d1b48a1: 1b48 A:80-222 [17703]
    Other proteins in same PDB: d1b48a2, d1b48b2
    complexed with gsh, hag

Details for d1b48a1

PDB Entry: 1b48 (more details), 2.6 Å

PDB Description: crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4
PDB Compounds: (A:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1b48a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]}
nlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydlilsraktryfpvfeki
lkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisniptikkflq
pgsqrkpppdgpyvevvrivlkf

SCOPe Domain Coordinates for d1b48a1:

Click to download the PDB-style file with coordinates for d1b48a1.
(The format of our PDB-style files is described here.)

Timeline for d1b48a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b48a2