Lineage for d1b48b1 (1b48 B:80-222)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 protein domains)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3861Species Mouse (Mus musculus), class alpha (a1-4) [TaxId:10090] [47628] (2 PDB entries)
  8. 3863Domain d1b48b1: 1b48 B:80-222 [17704]
    Other proteins in same PDB: d1b48a2, d1b48b2

Details for d1b48b1

PDB Entry: 1b48 (more details), 2.6 Å

PDB Description: crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4

SCOP Domain Sequences for d1b48b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b48b1 a.45.1.1 (B:80-222) Glutathione S-transferase {Mouse (Mus musculus), class alpha (a1-4)}
nlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydlilsraktryfpvfeki
lkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisniptikkflq
pgsqrkpppdgpyvevvrivlkf

SCOP Domain Coordinates for d1b48b1:

Click to download the PDB-style file with coordinates for d1b48b1.
(The format of our PDB-style files is described here.)

Timeline for d1b48b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b48b2