![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class alpha GST [81360] (8 species) |
![]() | Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [52873] (2 PDB entries) |
![]() | Domain d1b48b2: 1b48 B:2-79 [32998] Other proteins in same PDB: d1b48a1, d1b48b1 complexed with gsh, hag |
PDB Entry: 1b48 (more details), 2.6 Å
SCOPe Domain Sequences for d1b48b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b48b2 c.47.1.5 (B:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} aakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveid gmmltqtrailsylaaky
Timeline for d1b48b2: