SCOPe 2.04: Domain d2zr1a_: 2zr1 A:

Lineage for d2zr1a_ (2zr1 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Abrus precatorius [TaxId:3816] [189038] (1 PDB entry)

8. Domain d2zr1a_: 2zr1 A: [171445]
   Other proteins in same PDB: d2zr1b1, d2zr1b2, d2zr1d1, d2zr1d2
   automated match to d2q3na1
   complexed with nag, ndg

Details for d2zr1a_

PDB Entry: 2zr1, 2.6 Å

PDB Description: agglutinin from abrus precatorius

PDB Compounds: (A:) Agglutinin-1 chain A

SCOPe Domain Sequences for d2zr1a_:

Sequence; same for both SEQRES and ATOM records:

>d2zr1a_ d.165.1.1 (A:) automated matches {Abrus precatorius [TaxId: 3816]}
qdpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdt
vsiqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwah
qsrqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsn
raafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsala
lmlfvcnpln

Timeline for d2zr1a_:

• d2zr1a_ first appeared in SCOPe 2.01
  
• d2zr1a_ appears in SCOPe 2.03
  
• d2zr1a_ appears in SCOPe 2.05
  
• d2zr1a_ appears in the current release, SCOPe 2.08