Lineage for d2zr1d2 (2zr1 D:141-267)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1543434Protein Agglutinin-1 chain B [159150] (1 species)
  7. 1543435Species Abrus precatorius [TaxId:3816] [159151] (2 PDB entries)
    Uniprot Q9M6E9 287-420! Uniprot Q9M6E9 421-547
  8. 1543439Domain d2zr1d2: 2zr1 D:141-267 [198812]
    Other proteins in same PDB: d2zr1a_, d2zr1c_
    automated match to d2q3nb1
    complexed with nag, ndg

Details for d2zr1d2

PDB Entry: 2zr1 (more details), 2.6 Å

PDB Description: agglutinin from abrus precatorius
PDB Compounds: (D:) Agglutinin-1 chain B

SCOPe Domain Sequences for d2zr1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zr1d2 b.42.2.1 (D:141-267) Agglutinin-1 chain B {Abrus precatorius [TaxId: 3816]}
dtspfvtsiagffklcmeahgnsmwldvcditkeeqqwavypdgsirpvqntnncltcee
hkqgativmmgcsnawasqrwvfksdgtiynlyddmvmdvkssdpslkqiilwpytgnan
qmwatlf

SCOPe Domain Coordinates for d2zr1d2:

Click to download the PDB-style file with coordinates for d2zr1d2.
(The format of our PDB-style files is described here.)

Timeline for d2zr1d2: