| Class b: All beta proteins [48724] (176 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
| Protein Agglutinin-1 chain B [159150] (1 species) |
| Species Abrus precatorius [TaxId:3816] [159151] (2 PDB entries) Uniprot Q9M6E9 287-420! Uniprot Q9M6E9 421-547 |
| Domain d2zr1d1: 2zr1 D:5-140 [198811] Other proteins in same PDB: d2zr1a_, d2zr1c_ automated match to d2q3nb2 complexed with nag, ndg |
PDB Entry: 2zr1 (more details), 2.6 Å
SCOPe Domain Sequences for d2zr1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zr1d1 b.42.2.1 (D:5-140) Agglutinin-1 chain B {Abrus precatorius [TaxId: 3816]}
skicsshyeptvriggrdglcvdvsdnaynngnpiilwkckdqlevnqlwtlksdktirs
kgkclttygyapgnyvmiydcssavaeatywdiwdngtiinpksglvlsaesssmggtlt
vqkndyrmrqgwrtgn
Timeline for d2zr1d1:
View in 3DDomains from other chains: (mouse over for more information) d2zr1a_, d2zr1b1, d2zr1b2, d2zr1c_ |