Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (9 species) not a true protein |
Species Abrus precatorius [TaxId:3816] [189038] (4 PDB entries) |
Domain d2zr1a_: 2zr1 A: [171445] Other proteins in same PDB: d2zr1b1, d2zr1b2, d2zr1d1, d2zr1d2 automated match to d2q3na1 complexed with nag |
PDB Entry: 2zr1 (more details), 2.6 Å
SCOPe Domain Sequences for d2zr1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zr1a_ d.165.1.1 (A:) automated matches {Abrus precatorius [TaxId: 3816]} qdpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdt vsiqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwah qsrqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsn raafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsala lmlfvcnpln
Timeline for d2zr1a_: