Lineage for d2zr1a_ (2zr1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000148Species Abrus precatorius [TaxId:3816] [189038] (4 PDB entries)
  8. 3000152Domain d2zr1a_: 2zr1 A: [171445]
    Other proteins in same PDB: d2zr1b1, d2zr1b2, d2zr1d1, d2zr1d2
    automated match to d2q3na1
    complexed with nag

Details for d2zr1a_

PDB Entry: 2zr1 (more details), 2.6 Å

PDB Description: agglutinin from abrus precatorius
PDB Compounds: (A:) Agglutinin-1 chain A

SCOPe Domain Sequences for d2zr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zr1a_ d.165.1.1 (A:) automated matches {Abrus precatorius [TaxId: 3816]}
qdpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdt
vsiqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwah
qsrqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsn
raafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsala
lmlfvcnpln

SCOPe Domain Coordinates for d2zr1a_:

Click to download the PDB-style file with coordinates for d2zr1a_.
(The format of our PDB-style files is described here.)

Timeline for d2zr1a_: