PDB entry 2zr1

View 2zr1 on RCSB PDB site
Description: Agglutinin from Abrus Precatorius
Class: plant protein
Keywords: RIBOSOME-INACTIVATING PROTEIN, IMMUNOTOXIN, AGGLUTININ ABRIN, Glycoprotein, Hydrolase, Lectin, Plant defense, Protein synthesis inhibitor, Pyrrolidone carboxylic acid, Toxin, PLANT PROTEIN
Deposited on 2008-08-22, released 2009-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agglutinin-1 chain A
    Species: Abrus precatorius [TaxId:3816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zr1a_
  • Chain 'B':
    Compound: Agglutinin-1 chain B
    Species: Abrus precatorius [TaxId:3816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zr1b1, d2zr1b2
  • Chain 'C':
    Compound: Agglutinin-1 chain A
    Species: Abrus precatorius [TaxId:3816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zr1c_
  • Chain 'D':
    Compound: Agglutinin-1 chain B
    Species: Abrus precatorius [TaxId:3816]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zr1d1, d2zr1d2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zr1A (A:)
    qdpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdt
    vsiqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwah
    qsrqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsn
    raafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsala
    lmlfvcnplnatqsplli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zr1A (A:)
    qdpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdt
    vsiqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwah
    qsrqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsn
    raafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsala
    lmlfvcnpln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zr1B (B:)
    vveqskicsshyeptvriggrdglcvdvsdnaynngnpiilwkckdqlevnqlwtlksdk
    tirskgkclttygyapgnyvmiydcssavaeatywdiwdngtiinpksglvlsaesssmg
    gtltvqkndyrmrqgwrtgndtspfvtsiagffklcmeahgnsmwldvcditkeeqqwav
    ypdgsirpvqntnncltceehkqgativmmgcsnawasqrwvfksdgtiynlyddmvmdv
    kssdpslkqiilwpytgnanqmwatlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zr1B (B:)
    skicsshyeptvriggrdglcvdvsdnaynngnpiilwkckdqlevnqlwtlksdktirs
    kgkclttygyapgnyvmiydcssavaeatywdiwdngtiinpksglvlsaesssmggtlt
    vqkndyrmrqgwrtgndtspfvtsiagffklcmeahgnsmwldvcditkeeqqwavypdg
    sirpvqntnncltceehkqgativmmgcsnawasqrwvfksdgtiynlyddmvmdvkssd
    pslkqiilwpytgnanqmwatlf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zr1C (C:)
    qdpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdt
    vsiqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwah
    qsrqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsn
    raafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsala
    lmlfvcnplnatqsplli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zr1C (C:)
    qdpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdt
    vsiqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwah
    qsrqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsn
    raafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsala
    lmlfvcnpln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zr1D (D:)
    vveqskicsshyeptvriggrdglcvdvsdnaynngnpiilwkckdqlevnqlwtlksdk
    tirskgkclttygyapgnyvmiydcssavaeatywdiwdngtiinpksglvlsaesssmg
    gtltvqkndyrmrqgwrtgndtspfvtsiagffklcmeahgnsmwldvcditkeeqqwav
    ypdgsirpvqntnncltceehkqgativmmgcsnawasqrwvfksdgtiynlyddmvmdv
    kssdpslkqiilwpytgnanqmwatlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zr1D (D:)
    skicsshyeptvriggrdglcvdvsdnaynngnpiilwkckdqlevnqlwtlksdktirs
    kgkclttygyapgnyvmiydcssavaeatywdiwdngtiinpksglvlsaesssmggtlt
    vqkndyrmrqgwrtgndtspfvtsiagffklcmeahgnsmwldvcditkeeqqwavypdg
    sirpvqntnncltceehkqgativmmgcsnawasqrwvfksdgtiynlyddmvmdvkssd
    pslkqiilwpytgnanqmwatlf