Lineage for d2q3na1 (2q3n A:2-248)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2999980Protein Agglutinin-1 chain A [160917] (1 species)
  7. 2999981Species Abrus precatorius [TaxId:3816] [160918] (1 PDB entry)
    Uniprot Q9M6E9 22-268
  8. 2999982Domain d2q3na1: 2q3n A:2-248 [150034]
    Other proteins in same PDB: d2q3nb1, d2q3nb2
    complexed with nag

Details for d2q3na1

PDB Entry: 2q3n (more details), 3.5 Å

PDB Description: agglutinin from abrus precatorius (apa-i)
PDB Compounds: (A:) Agglutinin-1 A chain

SCOPe Domain Sequences for d2q3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3na1 d.165.1.1 (A:2-248) Agglutinin-1 chain A {Abrus precatorius [TaxId: 3816]}
dpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdtv
siqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwahq
srqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsnr
aafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsalal
mlfvcnp

SCOPe Domain Coordinates for d2q3na1:

Click to download the PDB-style file with coordinates for d2q3na1.
(The format of our PDB-style files is described here.)

Timeline for d2q3na1: