SCOPe 2.07: Domain d2y69t_: 2y69 T:

Lineage for d2y69t_ (2y69 T:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein automated matches [191230] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [189651] (1 PDB entry)

8. Domain d2y69t_: 2y69 T: [170644]
   Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
   automated match to d1occg_
   complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69t_

PDB Entry: 2y69, 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen

PDB Compounds: (T:) cytochrome c oxidase polypeptide 6a2

SCOPe Domain Sequences for d2y69t_:

Sequence; same for both SEQRES and ATOM records:

>d2y69t_ f.23.2.1 (T:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d2y69t_:

• d2y69t_ first appeared in SCOPe 2.01
  
• d2y69t_ appears in SCOPe 2.06
  
• d2y69t_ appears in the current release, SCOPe 2.08