Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries) |
Domain d2y69b2: 2y69 B:91-227 [198669] Other proteins in same PDB: d2y69a_, d2y69b1, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_ automated match to d1v54b1 complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn |
PDB Entry: 2y69 (more details), 1.95 Å
SCOPe Domain Sequences for d2y69b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y69b2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]} nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv lelvplkyfekwsasml
Timeline for d2y69b2:
View in 3D Domains from other chains: (mouse over for more information) d2y69a_, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_ |