SCOPe 2.07: Domain d2y69r_: 2y69 R:

Lineage for d2y69r_ (2y69 R:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein automated matches [254653] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255695] (3 PDB entries)

8. Domain d2y69r_: 2y69 R: [239029]
   Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
   automated match to d1ocre_
   complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69r_

PDB Entry: 2y69, 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen

PDB Compounds: (R:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d2y69r_:

Sequence; same for both SEQRES and ATOM records:

>d2y69r_ a.118.11.1 (R:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d2y69r_:

• d2y69r_ first appeared in SCOPe 2.04
  
• d2y69r_ appears in SCOPe 2.06
  
• d2y69r_ appears in the current release, SCOPe 2.08