Lineage for d2y69n_ (2y69 N:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632417Protein automated matches [190134] (4 species)
    not a true protein
  7. 2632418Species Cow (Bos taurus) [TaxId:9913] [187061] (18 PDB entries)
  8. 2632445Domain d2y69n_: 2y69 N: [170642]
    Other proteins in same PDB: d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
    automated match to d1occa_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69n_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d2y69n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69n_ f.24.1.1 (N:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
finrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvtah
afvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmveag
agtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyqt
plfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffghp
evyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvdt
rayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlans
sldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvgv
nmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskre
vltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d2y69n_:

Click to download the PDB-style file with coordinates for d2y69n_.
(The format of our PDB-style files is described here.)

Timeline for d2y69n_: