SCOPe 2.07: Domain d2y69i_: 2y69 I:

Lineage for d2y69i_ (2y69 I:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)
   automatically mapped to Pfam PF02937

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (52 PDB entries)

8. Domain d2y69i_: 2y69 I: [170640]
   Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
   automated match to d1occi_
   complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69i_

PDB Entry: 2y69, 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen

PDB Compounds: (I:) Cytochrome c oxidase polypeptide VIc

SCOPe Domain Sequences for d2y69i_:

Sequence; same for both SEQRES and ATOM records:

>d2y69i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
mrkagifqsak

Timeline for d2y69i_:

• d2y69i_ first appeared in SCOPe 2.01
  
• d2y69i_ appears in SCOPe 2.06
  
• d2y69i_ appears in the current release, SCOPe 2.08