Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries) |
Domain d2y69b1: 2y69 B:1-90 [198668] Other proteins in same PDB: d2y69a_, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_ automated match to d1v54b2 complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn |
PDB Entry: 2y69 (more details), 1.95 Å
SCOPe Domain Sequences for d2y69b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y69b1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d2y69b1:
View in 3D Domains from other chains: (mouse over for more information) d2y69a_, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_ |