SCOPe 2.08: Domain d1rh2c_: 1rh2 C:

Lineage for d1rh2c_ (1rh2 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-alpha 2b [47312] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47313] (1 PDB entry)

8. Domain d1rh2c_: 1rh2 C: [16895]
   CA-atoms only
   complexed with zn

Details for d1rh2c_

PDB Entry: 1rh2, 2.9 Å

PDB Description: recombinant human interferon-alpha 2b

PDB Compounds: (C:) interferon-alpha 2b

SCOPe Domain Sequences for d1rh2c_:

Sequence, based on SEQRES records:

>d1rh2c_ a.26.1.3 (C:) Interferon-alpha 2b {Human (Homo sapiens) [TaxId: 9606]}
srrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfstk
dssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavrkyfqritlyl
kekkyspcawevvraeimrsfslstn

Sequence, based on observed residues (ATOM records):

>d1rh2c_ a.26.1.3 (C:) Interferon-alpha 2b {Human (Homo sapiens) [TaxId: 9606]}
srrtlmllaqmrrislfsclkdrhdfgfpqeefgaetipvlhemiqqifnlfstkdssaa
wdetlldkfytelyqqlnedsilavrkyfqritlylkekkyspcawevvraeimrsfsls
tn

Timeline for d1rh2c_:

• d1rh2c_ first appeared (with stable ids) in SCOP 1.55
  
• d1rh2c_ appears in SCOPe 2.07