Lineage for d1rh2e_ (1rh2 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705807Protein Interferon-alpha 2b [47312] (1 species)
  7. 2705808Species Human (Homo sapiens) [TaxId:9606] [47313] (1 PDB entry)
  8. 2705813Domain d1rh2e_: 1rh2 E: [16897]
    CA-atoms only
    complexed with zn

Details for d1rh2e_

PDB Entry: 1rh2 (more details), 2.9 Å

PDB Description: recombinant human interferon-alpha 2b
PDB Compounds: (E:) interferon-alpha 2b

SCOPe Domain Sequences for d1rh2e_:

Sequence, based on SEQRES records: (download)

>d1rh2e_ a.26.1.3 (E:) Interferon-alpha 2b {Human (Homo sapiens) [TaxId: 9606]}
slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlf
stkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavrkyfqrit
lylkekkyspcawevvraeimrsfslstnlq

Sequence, based on observed residues (ATOM records): (download)

>d1rh2e_ a.26.1.3 (E:) Interferon-alpha 2b {Human (Homo sapiens) [TaxId: 9606]}
slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgaetipvlhemiqqifnlfstkds
saawdetlldkfytelyqqlndleanedsilavrkyfqritlylkekkyspcawevvrae
imrsfslstnlq

SCOPe Domain Coordinates for d1rh2e_:

Click to download the PDB-style file with coordinates for d1rh2e_.
(The format of our PDB-style files is described here.)

Timeline for d1rh2e_: