PDB entry 1rh2

View 1rh2 on RCSB PDB site
Description: recombinant human interferon-alpha 2b
Class: cytokine
Keywords: interferon, cytokine, anti-viral, immunomodulator, 4 helix bundle
Deposited on 1996-11-07, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.227
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon-alpha 2b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01563
      • conflict (22)
      • conflict (111)
    Domains in SCOPe 2.07: d1rh2a_
  • Chain 'B':
    Compound: interferon-alpha 2b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01563
      • conflict (22)
      • conflict (111)
    Domains in SCOPe 2.07: d1rh2b_
  • Chain 'C':
    Compound: interferon-alpha 2b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01563
      • conflict (22)
      • conflict (111)
    Domains in SCOPe 2.07: d1rh2c_
  • Chain 'D':
    Compound: interferon-alpha 2b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01563
      • conflict (22)
      • conflict (111)
    Domains in SCOPe 2.07: d1rh2d_
  • Chain 'E':
    Compound: interferon-alpha 2b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01563
      • conflict (22)
      • conflict (111)
    Domains in SCOPe 2.07: d1rh2e_
  • Chain 'F':
    Compound: interferon-alpha 2b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01563
      • conflict (22)
      • conflict (111)
    Domains in SCOPe 2.07: d1rh2f_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rh2A (A:)
    cdlpqthslgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rh2A (A:)
    thslgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifn
    lfstkdssaawdetlldkfytelyqqlndleacviqgnedsilavrkyfqritlylkekk
    yspcawevvraeimrsfslstnlqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rh2B (B:)
    cdlpqthslgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rh2B (B:)
    slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgaetipvlhemiqqifnlfstkds
    saawdetlldkfytelyqqlndleacviqgnedsilavrkyfqritlylkekkyspcawe
    vvraeimrsfslstnlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rh2C (C:)
    cdlpqthslgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rh2C (C:)
    srrtlmllaqmrrislfsclkdrhdfgfpqeefgaetipvlhemiqqifnlfstkdssaa
    wdetlldkfytelyqqlnedsilavrkyfqritlylkekkyspcawevvraeimrsfsls
    tn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rh2D (D:)
    cdlpqthslgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rh2D (D:)
    slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgaetipvlhemiqqifnlfstkds
    saawdetlldkfytelyqqlndlenedsilavrkyfqritlylkekkyspcawevvraei
    mrsfslstnlq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rh2E (E:)
    cdlpqthslgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rh2E (E:)
    slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgaetipvlhemiqqifnlfstkds
    saawdetlldkfytelyqqlndleanedsilavrkyfqritlylkekkyspcawevvrae
    imrsfslstnlq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rh2F (F:)
    cdlpqthslgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rh2F (F:)
    gsrrtlmllaqmrrislfsclkdrhdfgfpqeeftipvlhemiqqifnlfstkdssaawd
    etlldkfytelyqqlnedsilavrkyfqritlylkekkyspcawevvraeimrsfslstn