Lineage for d1eqze_ (1eqz E:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) Protein Histone H2A [47115] (3 species) Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries) 
Domain d1eqze_: 1eqz E: [16437]
Other proteins in same PDB: d1eqzb_, d1eqzc_, d1eqzd_, d1eqzf_, d1eqzg_, d1eqzh_
Details for d1eqze_
PDB Entry: 1eqz (more details), 2.5 Å
PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
SCOP Domain Sequences for d1eqze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqze_ a.22.1.1 (E:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
grgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltae
ilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkktd
shkakak
SCOP Domain Coordinates for d1eqze_:
Click to download the PDB-style file with coordinates for d1eqze_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eqze_:
- d1eqze_ appears in SCOP 1.57
- d1eqze_ appears in the current release, SCOPe 2.08
View in 3D
