Lineage for d1eqze_ (1eqz E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698141Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries)
    Uniprot P02263
  8. 2698149Domain d1eqze_: 1eqz E: [16437]
    Other proteins in same PDB: d1eqzb_, d1eqzc_, d1eqzd_, d1eqzf_, d1eqzg_, d1eqzh_
    protein/DNA complex; complexed with cac, cl, k, mn

Details for d1eqze_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
PDB Compounds: (E:) protein (histone h2a)

SCOPe Domain Sequences for d1eqze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqze_ a.22.1.1 (E:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
grgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltae
ilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkktd
shkakak

SCOPe Domain Coordinates for d1eqze_:

Click to download the PDB-style file with coordinates for d1eqze_.
(The format of our PDB-style files is described here.)

Timeline for d1eqze_: