Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (7 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries) Uniprot P02263 |
Domain d1eqze_: 1eqz E: [16437] Other proteins in same PDB: d1eqzb_, d1eqzc_, d1eqzd_, d1eqzf_, d1eqzg_, d1eqzh_ protein/DNA complex; complexed with cac, cl, k, mn |
PDB Entry: 1eqz (more details), 2.5 Å
SCOPe Domain Sequences for d1eqze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqze_ a.22.1.1 (E:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} grgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltae ilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkktd shkakak
Timeline for d1eqze_: