Lineage for d1eqzh_ (1eqz H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698538Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries)
    Uniprot P62801
  8. 2698546Domain d1eqzh_: 1eqz H: [16467]
    Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzc_, d1eqze_, d1eqzf_, d1eqzg_
    protein/DNA complex; complexed with cac, cl, k, mn

Details for d1eqzh_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
PDB Compounds: (H:) protein (histone h4)

SCOPe Domain Sequences for d1eqzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqzh_ a.22.1.1 (H:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
kglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvir
davtytehakrktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1eqzh_:

Click to download the PDB-style file with coordinates for d1eqzh_.
(The format of our PDB-style files is described here.)

Timeline for d1eqzh_: