PDB entry 1eqz

View 1eqz on RCSB PDB site
Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
Class: structural protein/DNA
Keywords: nucleosome, nucleosome core particle, histone, microgravity histone octamer, DNA palindrome, DNA protein complex, chromatin, chromosomal protein, histone fold, bent DNA, structural protein-DNA complex
Deposited on 2000-04-06, released 2000-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (histone h2a)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqza_
  • Chain 'B':
    Compound: protein (histone h2b)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqzb_
  • Chain 'C':
    Compound: protein (histone h3)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqzc_
  • Chain 'D':
    Compound: protein (histone h4)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqzd_
  • Chain 'E':
    Compound: protein (histone h2a)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqze_
  • Chain 'F':
    Compound: protein (histone h2b)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqzf_
  • Chain 'G':
    Compound: protein (histone h3)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqzg_
  • Chain 'H':
    Compound: protein (histone h4)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eqzh_
  • Chain 'I':
    Compound: 146 nucleotides long DNA
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: 146 nucleotides long DNA
    Species: synthetic, synthetic
  • Heterogens: K, MN, CL, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqzA (A:)
    msgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylt
    aeilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkk
    tdshkakak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzA (A:)
    sgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkkt
    dshka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eqzB (B:)
    mpepaksapapkkgskkavtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzB (B:)
    vtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiagea
    srlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eqzC (C:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzC (C:)
    apatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssa
    vmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eqzD (D:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzD (D:)
    gakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyt
    ehakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1eqzE (E:)
    msgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylt
    aeilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkk
    tdshkakak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzE (E:)
    grgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltae
    ilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkktd
    shkakak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1eqzF (F:)
    mpepaksapapkkgskkavtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzF (F:)
    tktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageas
    rlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1eqzG (G:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzG (G:)
    prkqlatkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreia
    qdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1eqzH (H:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqzH (H:)
    kglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvir
    davtytehakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.