Lineage for d1eqze_ (1eqz E:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46311Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 46312Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 46313Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 46314Protein Histone H2A [47115] (3 species)
  7. 46318Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries)
  8. 46322Domain d1eqze_: 1eqz E: [16437]
    Other proteins in same PDB: d1eqzb_, d1eqzc_, d1eqzd_, d1eqzf_, d1eqzg_, d1eqzh_

Details for d1eqze_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqze_ a.22.1.1 (E:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
grgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltae
ilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkktd
shkakak

SCOP Domain Coordinates for d1eqze_:

Click to download the PDB-style file with coordinates for d1eqze_.
(The format of our PDB-style files is described here.)

Timeline for d1eqze_: