Lineage for d1eqzf_ (1eqz F:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) 
Protein Histone H2B [47119] (2 species) Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (4 PDB entries) 
Domain d1eqzf_: 1eqz F: [16447]
Other proteins in same PDB: d1eqza_, d1eqzc_, d1eqzd_, d1eqze_, d1eqzg_, d1eqzh_
Details for d1eqzf_
PDB Entry: 1eqz (more details), 2.5 Å
PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
SCOP Domain Sequences for d1eqzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqzf_ a.22.1.1 (F:) Histone H2B {Chicken (Gallus gallus), erythrocytes}
tktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageas
rlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytssk
SCOP Domain Coordinates for d1eqzf_:
Click to download the PDB-style file with coordinates for d1eqzf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eqzf_:
- d1eqzf_ appears in SCOP 1.57
- d1eqzf_ appears in the current release, SCOPe 2.08
View in 3D
