Lineage for d1b72a_ (1b72 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691844Protein Homeobox protein hox-b1 [46709] (1 species)
  7. 2691845Species Human (Homo sapiens) [TaxId:9606] [46710] (1 PDB entry)
  8. 2691846Domain d1b72a_: 1b72 A: [16000]
    Other proteins in same PDB: d1b72b_
    protein/DNA complex

Details for d1b72a_

PDB Entry: 1b72 (more details), 2.35 Å

PDB Description: pbx1, homeobox protein hox-b1/dna ternary complex
PDB Compounds: (A:) protein (homeobox protein hox-b1)

SCOPe Domain Sequences for d1b72a_:

Sequence, based on SEQRES records: (download)

>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]}
artfdwmkvkrnppktakvsepglgspsglrtnfttrqltelekefhfnkylsrarrvei
aatlelnetqvkiwfqnrrmkqkkrere

Sequence, based on observed residues (ATOM records): (download)

>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]}
artfdwmkvlrtnfttrqltelekefhfnkylsrarrveiaatlelnetqvkiwfqnrrm
kqkkrere

SCOPe Domain Coordinates for d1b72a_:

Click to download the PDB-style file with coordinates for d1b72a_.
(The format of our PDB-style files is described here.)

Timeline for d1b72a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b72b_