Lineage for d1b72b_ (1b72 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691929Protein pbx1 [46711] (2 species)
  7. 2691930Species Human (Homo sapiens) [TaxId:9606] [46712] (2 PDB entries)
  8. 2691932Domain d1b72b_: 1b72 B: [16001]
    Other proteins in same PDB: d1b72a_
    protein/DNA complex

Details for d1b72b_

PDB Entry: 1b72 (more details), 2.35 Å

PDB Description: pbx1, homeobox protein hox-b1/dna ternary complex
PDB Compounds: (B:) protein (pbx1)

SCOPe Domain Sequences for d1b72b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b72b_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]}
rkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkrirykkn
igkfqeeaniyaa

SCOPe Domain Coordinates for d1b72b_:

Click to download the PDB-style file with coordinates for d1b72b_.
(The format of our PDB-style files is described here.)

Timeline for d1b72b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b72a_