![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein pbx1 [46711] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46712] (2 PDB entries) |
![]() | Domain d1b72b_: 1b72 B: [16001] Other proteins in same PDB: d1b72a_ protein/DNA complex |
PDB Entry: 1b72 (more details), 2.35 Å
SCOPe Domain Sequences for d1b72b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b72b_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} rkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkrirykkn igkfqeeaniyaa
Timeline for d1b72b_: