Lineage for d1b72a_ (1b72 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (9 families) 
Family a.4.1.1: Homeodomain [46690] (18 proteins) 
Protein Homeobox protein hox-b1 [46709] (1 species) Species Human (Homo sapiens) [TaxId:9606] [46710] (1 PDB entry) 
Domain d1b72a_: 1b72 A: [16000]
Other proteins in same PDB: d1b72b_
Details for d1b72a_
PDB Entry: 1b72 (more details), 2.35 Å
PDB Description: pbx1, homeobox protein hox-b1/dna ternary complex
SCOP Domain Sequences for d1b72a_:
Sequence, based on SEQRES records: (download)
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens)}
artfdwmkvkrnppktakvsepglgspsglrtnfttrqltelekefhfnkylsrarrvei
aatlelnetqvkiwfqnrrmkqkkrere
Sequence, based on observed residues (ATOM records): (download)
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens)}
artfdwmkvlrtnfttrqltelekefhfnkylsrarrveiaatlelnetqvkiwfqnrrm
kqkkrere
SCOP Domain Coordinates for d1b72a_:
Click to download the PDB-style file with coordinates for d1b72a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b72a_:
- d1b72a_ appears in SCOP 1.57
- d1b72a_ appears in the current release, SCOPe 2.08
View in 3D
