Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein mat alpha2 Homeodomain [46695] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries) |
Domain d1mnmd_: 1mnm D: [15984] Other proteins in same PDB: d1mnma_, d1mnmb_ protein/DNA complex |
PDB Entry: 1mnm (more details), 2.25 Å
SCOPe Domain Sequences for d1mnmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mnmd_ a.4.1.1 (D:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls riqiknwvsnrrrkekt
Timeline for d1mnmd_: