Lineage for d1mnmd_ (1mnm D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691880Protein mat alpha2 Homeodomain [46695] (1 species)
  7. 2691881Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries)
  8. 2691890Domain d1mnmd_: 1mnm D: [15984]
    Other proteins in same PDB: d1mnma_, d1mnmb_
    protein/DNA complex

Details for d1mnmd_

PDB Entry: 1mnm (more details), 2.25 Å

PDB Description: yeast matalpha2/mcm1/dna ternary transcription complex crystal structure
PDB Compounds: (D:) protein (mat alpha-2 transcriptional repressor)

SCOPe Domain Sequences for d1mnmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnmd_ a.4.1.1 (D:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
riqiknwvsnrrrkekt

SCOPe Domain Coordinates for d1mnmd_:

Click to download the PDB-style file with coordinates for d1mnmd_.
(The format of our PDB-style files is described here.)

Timeline for d1mnmd_: