PDB entry 1mnm

View 1mnm on RCSB PDB site
Description: yeast matalpha2/mcm1/DNA ternary transcription complex crystal structure
Class: transcription/DNA
Keywords: transcription regulation, transcriptional repression, DNA-binding protein, complex (transcription-homeobox-DNA), transcription-DNA complex
Deposited on 1997-11-03, released 1998-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mcm1 transcriptional regulator)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mnma_
  • Chain 'B':
    Compound: protein (mcm1 transcriptional regulator)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mnmb_
  • Chain 'C':
    Compound: protein (mat alpha-2 transcriptional repressor)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mnmc_
  • Chain 'D':
    Compound: protein (mat alpha-2 transcriptional repressor)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mnmd_
  • Chain 'E':
    Compound: DNA (ste6 operator DNA)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (ste6 operator DNA)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mnmA (A:)
    msdieegtptnngqqkerrkieikfienktrrhvtfskrkhgimkkafelsvltgtqvll
    lvvsetglvytfstpkfepivtqqegrnliqaclnapdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnmA (A:)
    qkerrkieikfienktrrhvtfskrkhgimkkafelsvltgtqvlllvvsetglvytfst
    pkfepivtqqegrnliqaclnapdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mnmB (B:)
    msdieegtptnngqqkerrkieikfienktrrhvtfskrkhgimkkafelsvltgtqvll
    lvvsetglvytfstpkfepivtqqegrnliqaclnapdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnmB (B:)
    rrkieikfienktrrhvtfskrkhgimkkafelsvltgtqvlllvvsetglvytfstpkf
    epivtqqegrnliqaclnapd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mnmC (C:)
    qltqknksadglvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkgl
    enlmkntslsriqiknwvsnrrrkekt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnmC (C:)
    glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
    riqiknwvsnrrrkekt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mnmD (D:)
    qltqknksadglvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkgl
    enlmkntslsriqiknwvsnrrrkekt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnmD (D:)
    glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
    riqiknwvsnrrrkekt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.