Lineage for d1mnma_ (1mnm A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528558Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2528559Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 2528560Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2528561Protein MCM1 transcriptional regulator [55459] (1 species)
  7. 2528562Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55460] (1 PDB entry)
  8. 2528563Domain d1mnma_: 1mnm A: [40232]
    Other proteins in same PDB: d1mnmc_, d1mnmd_
    protein/DNA complex

Details for d1mnma_

PDB Entry: 1mnm (more details), 2.25 Å

PDB Description: yeast matalpha2/mcm1/dna ternary transcription complex crystal structure
PDB Compounds: (A:) protein (mcm1 transcriptional regulator)

SCOPe Domain Sequences for d1mnma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnma_ d.88.1.1 (A:) MCM1 transcriptional regulator {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qkerrkieikfienktrrhvtfskrkhgimkkafelsvltgtqvlllvvsetglvytfst
pkfepivtqqegrnliqaclnapdd

SCOPe Domain Coordinates for d1mnma_:

Click to download the PDB-style file with coordinates for d1mnma_.
(The format of our PDB-style files is described here.)

Timeline for d1mnma_: